PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_91212g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family ZF-HD
Protein Properties Length: 213aa    MW: 23782.7 Da    PI: 6.7263
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_91212g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer1071.1e-33103159360
    ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                    +vrY+eC+kNhAas+Gg+avDGCgEfmps geegt+ alkCaAC+CHRnFHRreve e
  MA_91212g0010 103 AVRYRECRKNHAASIGGYAVDGCGEFMPS-GEEGTSGALKCAACNCHRNFHRREVEGE 159
                    79**************************9.999*********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257746.0E-2498159IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.8E-31104156IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.4E-30105156IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.172106155IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MNREVQVSIP MPSNYHQTIQ ESSRLQQIYA KTLGIVEGMS PPEDLRSQVQ GMRPPHHVHE  60
TTAAARPGPP PPVHEDMRTQ QHQQQQHYPQ ENNRNADNIL IKAVRYRECR KNHAASIGGY  120
AVDGCGEFMP SGEEGTSGAL KCAACNCHRN FHRREVEGEN RLRGVYSAKV VQDLQLASLL  180
FDMPFSVADH CENGTLVDSL ALCQLTSEPG LCW
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6768970.0EF676897.1 Picea sitchensis clone WS02757_I03 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LM891e-117B8LM89_PICSI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.12e-27homeobox protein 21